PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462926296
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 308aa    MW: 33716.7 Da    PI: 8.4375
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462926296genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.61.4e-10241031298
                HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                +++ l++p + ae++g +++    +++   +g+  +v++   + +++ +l++GWkeF+ a g+ +g  +v++++g  ++ l+vk+f+
  462926296  24 SHKALRIPDELAEDIGAEEA---HVVVPFGKGKLRRVEV--GRDGDGAFLGRGWKEFAAACGVGAGWLLVLRHHG--SGVLTVKAFD 103
                67789**********97754...599999**********..999999*************************765..6668999997 PP

2B354.32.4e-171412131085
                HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
         B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                +  +  +vl   f++ +g+ + +++tl+    ++ sW+v+ + ++ +++y+l +GW++F+k+n Lk+gD+++F ++
  462926296 141 S--REKMVLAAAFCDGIGLHESRTVTLKTSVDRNASWQVRGCSQN-GSSYILFGGWRRFCKENSLKVGDICTFNVV 213
                3..4459***********99766656665557779******6544.45788999*******************965 PP

3B351.71.6e-162272991591
                -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
         B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                  +lp +f+e++g+ +++++tl+  ++s  sW+ ++    k ++++ ++GWk F+++n++k+gD+++F++++   ++
  462926296 227 EKSLPLTFCEAIGLREPCTITLKTSTSSTISWQARVV-PYKNCAHMRSSGWKTFCRQNEIKVGDVCTFTVVE---TK 299
                568************99999999999999*******4.4455679************************654...33 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508638.0513105IPR003340B3 DNA binding domain
SMARTSM010190.004716105IPR003340B3 DNA binding domain
SuperFamilySSF1019361.2E-1119107IPR015300DNA-binding pseudobarrel domain
PfamPF023621.0E-823103IPR003340B3 DNA binding domain
CDDcd100172.17E-624103No hitNo description
Gene3DG3DSA:2.40.330.108.7E-1225107IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-19126224IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.61E-17127226IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.21130226IPR003340B3 DNA binding domain
SMARTSM010191.7E-4133218IPR003340B3 DNA binding domain
CDDcd100174.09E-12136210No hitNo description
PfamPF023623.4E-14141214IPR003340B3 DNA binding domain
SMARTSM010190.0022219308IPR003340B3 DNA binding domain
PfamPF023626.6E-14226305IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.1E-15229306IPR015300DNA-binding pseudobarrel domain
CDDcd100172.56E-10229294No hitNo description
SuperFamilySSF1019362.35E-15229306IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.461230308IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009941Cellular Componentchloroplast envelope
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MASPGPSNPS AAAAKHMRVL LPFSHKALRI PDELAEDIGA EEAHVVVPFG KGKLRRVEVG  60
RDGDGAFLGR GWKEFAAACG VGAGWLLVLR HHGSGVLTVK AFDDSCCLRE LTTQTPAVDA  120
VDSSNDSPHK PQFIGLLPPD SREKMVLAAA FCDGIGLHES RTVTLKTSVD RNASWQVRGC  180
SQNGSSYILF GGWRRFCKEN SLKVGDICTF NVVEATLWNV VITRYSEKSL PLTFCEAIGL  240
REPCTITLKT STSSTISWQA RVVPYKNCAH MRSSGWKTFC RQNEIKVGDV CTFTVVETKL  300
WHVVITHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3YDR83e-79K3YDR8_SETIT; Uncharacterized protein
TrEMBLA0A0A9S1932e-77A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012375m1e-78(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31690.14e-16B3 family protein